PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aco015873.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Bromeliaceae; Ananas
Family TALE
Protein Properties Length: 372aa    MW: 41140.5 Da    PI: 7.1672
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aco015873.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox26.98.2e-092893271755
                  HHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
     Homeobox  17 elFeknrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                  el +k +yps++++  LA+++gL+ +q+ +WF N+R ++
  Aco015873.1 289 ELHYKWPYPSETQKVALAESTGLDLKQINNWFINQRKRH 327
                  5566789*****************************885 PP

2ELK30.67.7e-11247268122
          ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                  EL+++Ll+ YsgyLgsLkqE+s
  Aco015873.1 247 ELRQHLLKRYSGYLGSLKQELS 268
                  9*******************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012555.0E-8139186IPR005540KNOX1
PfamPF037906.8E-12140163IPR005540KNOX1
SMARTSM012562.6E-13153203IPR005541KNOX2
PfamPF037914.2E-15167201IPR005541KNOX2
SMARTSM011885.9E-6247268IPR005539ELK domain
PfamPF037891.9E-8247268IPR005539ELK domain
PROSITE profilePS5121310.72247267IPR005539ELK domain
PROSITE profilePS5007112.536267330IPR001356Homeobox domain
SuperFamilySSF466892.14E-19268344IPR009057Homeodomain-like
SMARTSM003893.1E-12269334IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.8E-27272331IPR009057Homeodomain-like
CDDcd000865.74E-12279331No hitNo description
PfamPF059204.1E-16287326IPR008422Homeobox KN domain
PROSITE patternPS000270305328IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 372 aa     Download sequence    Send to blast
MEEISQQFGG GNNPWGSLMY AFSSHSTTTT TTATATAAAA STATTNTAVV APAPHPQLAP  60
PPHLSSSSSG GHHLIPFTSC SNHPFHNHHH SNNNNNNSSS NNNNHNNHNH NHHPHLEPKP  120
NEEGSSSQVM IPANNGDVEA IKAKIISHPH YSSLLAAYLD CQKACFEAYH EMLVKYREEL  180
TRPLQEAMEF LRRVESQLNS LSLSNRSSLG GILSSDKCGA CSSEEDQDGS GGETDLRDLD  240
ARGEGQELRQ HLLKRYSGYL GSLKQELSKK KKKGKLPKDA RQQLLNWWEL HYKWPYPSET  300
QKVALAESTG LDLKQINNWF INQRKRHWKP SDEMQFVMMD GYHPPNAAAA AAAALYMDGH  360
FVNDGLYRFG P*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015629392.11e-119PREDICTED: homeobox protein knotted-1-like 6
SwissprotP466091e-121KNOS6_ORYSJ; Homeobox protein knotted-1-like 6
TrEMBLM0TL901e-120M0TL90_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr7P27540_0011e-120(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP98863145
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G08150.11e-83KNOTTED-like from Arabidopsis thaliana